PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi002170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family G2-like
Protein Properties Length: 366aa    MW: 40651.7 Da    PI: 7.5001
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Picea_sitchensis-2269PU_refplantGDBView CDS
gnl|UG|Psi#S37603394PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-32256155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               kprlrWt+eLHerFveav++LGG++kAtPk+++  m+v+gLtl+h+kSHLQkYRl
  Psi002170  2 KPRLRWTSELHERFVEAVTKLGGPDKATPKAVRTRMGVEGLTLYHLKSHLQKYRL 56
               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.61159IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-29157IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-25257IPR006447Myb domain, plants
SuperFamilySSF466891.4E-15257IPR009057Homeodomain-like
PfamPF002494.5E-9455IPR001005SANT/Myb domain
PfamPF143799.2E-27112158IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
PKPRLRWTSE LHERFVEAVT KLGGPDKATP KAVRTRMGVE GLTLYHLKSH LQKYRLGKQP  60
HKEVNVDTSR DGLSHGGPVA GYGSTACRVS EVQVACNSVP SIIPANMTDT LQITEALRMQ  120
MEVQRRLHEQ LEVQRHLQLR IEAQGKYLQS ILEKARETLA GYNVGSIGLE ATRAELSELA  180
SKVKSECFNS TFSALTFSTM PEIPGVLPES QIARQQSQVA DCSAYSCLTS NESSEKSPTE  240
NLQAGGRKRP RSAYDNKVQF WQDDIREDMS LQELTGEENL SSPSSRIKDS SIVFHERGTS  300
DIVQAEENGN RLSGQKGKEC EMNGVLVDPP ITRTLAFCSA LSMQENSQMY EATKVYTNQD  360
KTRSKG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264109.11e-83PREDICTED: myb family transcription factor APL-like isoform X1
TrEMBLC0PPV31e-101C0PPV3_PICSI; Putative uncharacterized protein
STRINGPOPTR_0013s05670.12e-72(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.12e-69G2-like family protein